PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_28215-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MIKC_MADS
Protein Properties Length: 256aa    MW: 28655.7 Da    PI: 9.6656
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_28215-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.61.1e-30959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     krien++ rqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyeys+
  TRIUR3_28215-P1  9 KRIENTTSRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYSN 59
                     79***********************************************95 PP

2K-box99.16.3e-33841759100
            K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                       e + ++++qqe+akL+ +i++Lq++++hl+G+++++LslkeL+qLe++Lek++ kiR++Knell ++i+++ k+e elq++n +Lr+k++e
  TRIUR3_28215-P1  84 IEVNAQQYYQQEAAKLRHQIQMLQSTNKHLVGDSVGNLSLKELKQLESRLEKGIAKIRARKNELLSSEINYMVKREIELQSDNIDLRTKIAE 175
                      5667899**********************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.529161IPR002100Transcription factor, MADS-box
CDDcd002651.95E-44274No hitNo description
SuperFamilySSF554551.31E-32274IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-32323IPR002100Transcription factor, MADS-box
PfamPF003191.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-323859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-2486173IPR002487Transcription factor, K-box
PROSITE profilePS5129714.25589179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048283Biological Processindeterminate inflorescence morphogenesis
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0080155Biological Processregulation of double fertilization forming a zygote and endosperm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRGRIEIKR IENTTSRQVT FCKRRNGLLK KAYELSVLCD AEVALIVFSS RGRLYEYSNN  60
SVKATIDRYK KAHACGSTSG VPLIEVNAQQ YYQQEAAKLR HQIQMLQSTN KHLVGDSVGN  120
LSLKELKQLE SRLEKGIAKI RARKNELLSS EINYMVKREI ELQSDNIDLR TKIAEEDQRM  180
QQVTIARPSA APELNPFTAL DMKCFFPANL FEAAVQAHAQ AQAQAQAQAH AQASLQLNLG  240
YQQLAPPGAG DVAHQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P3e-19169169Myocyte-specific enhancer factor 2B
1tqe_Q3e-19169169Myocyte-specific enhancer factor 2B
1tqe_R3e-19169169Myocyte-specific enhancer factor 2B
1tqe_S3e-19169169Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM5028650.0AM502865.1 Triticum aestivum mRNA for MIKC-type MADS-box transcription factor WM3B (WM3B gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003578791.11e-156PREDICTED: uncharacterized protein LOC100836399 isoform X2
SwissprotQ2QW531e-134MAD13_ORYSJ; MADS-box transcription factor 13
TrEMBLM7Z8520.0M7Z852_TRIUA; MADS-box transcription factor 13
STRINGMLOC_57890.11e-161(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42830.13e-84MIKC_MADS family protein